PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008225579.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 266aa    MW: 28827.3 Da    PI: 6.9404
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008225579.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.44.3e-428106199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvh+++Gasnv k+l++l++ +reda++sl+yeAear+rdPvyG+vg+i+ lq +l+q +++l 
  XP_008225579.1   8 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHRVYGASNVAKILNELNTAHREDAVTSLAYEAEARLRDPVYGCVGFISILQGKLKQIQTDLY 102
                     7*******************************************************************************************998 PP

          DUF260  96 llke 99 
                      +k+
  XP_008225579.1 103 NAKK 106
                     8876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.7377108IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-418105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MSSNTHSPCA ACKFLRRKCT QECVFAPYFP PDQPQKFANV HRVYGASNVA KILNELNTAH  60
REDAVTSLAY EAEARLRDPV YGCVGFISIL QGKLKQIQTD LYNAKKDLSA YIGPQALMIP  120
VFHPSQQTDV NASMPMLGIS NCPPPQHGCG GGQLMQQQQQ LFEAHQQELV RYNVNGMDAA  180
AANSVTGNGF NQMHAAAGTN GVVSAGSLGL GGGFDNNPYN HQIQPQQAAA AAAHHQHSLD  240
YQLQAQLMLQ PHQAQQSQLK SEGEES
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008225579.10.0PREDICTED: LOB domain-containing protein 6-like
SwissprotQ9FKZ36e-70LBD36_ARATH; LOB domain-containing protein 36
TrEMBLM5WIQ11e-159M5WIQ1_PRUPE; Uncharacterized protein
STRINGGLYMA11G06210.21e-75(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-64ASYMMETRIC LEAVES 2-like 1